SCOPe 2.03: Domain d4l6sb1: 4l6s B:660-796

Lineage for d4l6sb1 (4l6s B:660-796)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily)
   core: 4 helices: bundle; unusual topology

4. Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families)
   duplication: consists of 2 helix-loop-helix structural repeats
   automatically mapped to Pfam PF02877

5. Family a.41.1.0: automated matches [227223] (1 protein)
   not a true family

6. Protein automated matches [226964] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225405] (21 PDB entries)

8. Domain d4l6sb1: 4l6s B:660-796 [224571]
   Other proteins in same PDB: d4l6sa2, d4l6sb2
   automated match to d1gs0a1
   protein/DNA complex; complexed with 1wq

Details for d4l6sb1

PDB Entry: 4l6s, 2.2 Å

PDB Description: parp complexed with benzo[1,4]oxazin-3-one inhibitor

PDB Compounds: (B:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d4l6sb1:

Sequence; same for both SEQRES and ATOM records:

>d4l6sb1 a.41.1.0 (B:660-796) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hmksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqa
vsqgssdsqildlsnrfytliphdfgmkkppllnnadsvqakaemldnlldievaysllr
ggsddsskdpidvnyek

Timeline for d4l6sb1:

• d4l6sb1 is new in SCOPe 2.03-stable
  
• d4l6sb1 appears in SCOPe 2.04
  
• d4l6sb1 appears in the current release, SCOPe 2.08