Lineage for d4l6sb1 (4l6s B:660-796)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1270102Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily)
    core: 4 helices: bundle; unusual topology
  4. 1270103Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families) (S)
    duplication: consists of 2 helix-loop-helix structural repeats
    automatically mapped to Pfam PF02877
  5. 1270132Family a.41.1.0: automated matches [227223] (1 protein)
    not a true family
  6. 1270133Protein automated matches [226964] (1 species)
    not a true protein
  7. 1270134Species Human (Homo sapiens) [TaxId:9606] [225405] (21 PDB entries)
  8. 1270145Domain d4l6sb1: 4l6s B:660-796 [224571]
    Other proteins in same PDB: d4l6sa2, d4l6sb2
    automated match to d1gs0a1
    protein/DNA complex; complexed with 1wq

Details for d4l6sb1

PDB Entry: 4l6s (more details), 2.2 Å

PDB Description: parp complexed with benzo[1,4]oxazin-3-one inhibitor
PDB Compounds: (B:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d4l6sb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l6sb1 a.41.1.0 (B:660-796) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hmksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqa
vsqgssdsqildlsnrfytliphdfgmkkppllnnadsvqakaemldnlldievaysllr
ggsddsskdpidvnyek

SCOPe Domain Coordinates for d4l6sb1:

Click to download the PDB-style file with coordinates for d4l6sb1.
(The format of our PDB-style files is described here.)

Timeline for d4l6sb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4l6sb2