SCOPe 2.07: Domain d4l6sa2: 4l6s A:797-1011

Lineage for d4l6sa2 (4l6s A:797-1011)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families)

5. Family d.166.1.0: automated matches [191650] (1 protein)
   not a true family

6. Protein automated matches [191197] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225406] (55 PDB entries)

8. Domain d4l6sa2: 4l6s A:797-1011 [224570]
   Other proteins in same PDB: d4l6sa1, d4l6sa3, d4l6sb1, d4l6sb3
   automated match to d1gs0a2
   protein/DNA complex; complexed with 1wq

Details for d4l6sa2

PDB Entry: 4l6s, 2.2 Å

PDB Description: parp complexed with benzo[1,4]oxazin-3-one inhibitor

PDB Compounds: (A:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d4l6sa2:

Sequence; same for both SEQRES and ATOM records:

>d4l6sa2 d.166.1.0 (A:797-1011) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lktdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykpfkqlhn
rrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdpi
glillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvplgtgis
sgvndtsllyneyivydiaqvnlkyllklkfnfkt

Timeline for d4l6sa2:

• d4l6sa2 first appeared in SCOPe 2.03
  
• d4l6sa2 appears in SCOPe 2.06
  
• d4l6sa2 appears in the current release, SCOPe 2.08