Lineage for d1bvoa_ (1bvo A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2376992Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2377721Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 2378032Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (7 proteins)
    automatically mapped to Pfam PF00554
  6. 2378033Protein Dorsal homologue Gambif1 [49431] (1 species)
  7. 2378034Species African malaria mosquito (Anopheles gambiae) [TaxId:7165] [49432] (1 PDB entry)
  8. 2378035Domain d1bvoa_: 1bvo A: [22457]
    protein/DNA complex

Details for d1bvoa_

PDB Entry: 1bvo (more details), 2.7 Å

PDB Description: dorsal homologue gambif1 bound to dna
PDB Compounds: (A:) transcription factor gambif1

SCOPe Domain Sequences for d1bvoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bvoa_ b.2.5.3 (A:) Dorsal homologue Gambif1 {African malaria mosquito (Anopheles gambiae) [TaxId: 7165]}
pyveiteqphpkalrfryecegrsagsipgvnttaeqktfpsiqvhgyrgravvvvscvt
kegpehkphphnlvgkegckkgvctveinsttmsytfnnlgiqcvkkkdveealrlrqei
rvdpfrtgfghakepgsidlnavrlcfqvflegqqrgrftepltpvvsdiiydkk

SCOPe Domain Coordinates for d1bvoa_:

Click to download the PDB-style file with coordinates for d1bvoa_.
(The format of our PDB-style files is described here.)

Timeline for d1bvoa_: