| Class b: All beta proteins [48724] (180 folds) |
| Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.5: p53-like transcription factors [49417] (8 families) ![]() |
| Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (7 proteins) automatically mapped to Pfam PF00554 |
| Protein Dorsal homologue Gambif1 [49431] (1 species) |
| Species African malaria mosquito (Anopheles gambiae) [TaxId:7165] [49432] (1 PDB entry) |
| Domain d1bvoa_: 1bvo A: [22457] protein/DNA complex |
PDB Entry: 1bvo (more details), 2.7 Å
SCOPe Domain Sequences for d1bvoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bvoa_ b.2.5.3 (A:) Dorsal homologue Gambif1 {African malaria mosquito (Anopheles gambiae) [TaxId: 7165]}
pyveiteqphpkalrfryecegrsagsipgvnttaeqktfpsiqvhgyrgravvvvscvt
kegpehkphphnlvgkegckkgvctveinsttmsytfnnlgiqcvkkkdveealrlrqei
rvdpfrtgfghakepgsidlnavrlcfqvflegqqrgrftepltpvvsdiiydkk
Timeline for d1bvoa_: