| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families) ![]() |
| Family c.18.1.1: Uracil-DNA glycosylase [52142] (2 proteins) |
| Protein automated matches [190540] (4 species) not a true protein |
| Species Herpes simplex virus type 1 [TaxId:10299] [226744] (2 PDB entries) |
| Domain d4l5nb_: 4l5n B: [224566] automated match to d1laue_ protein/DNA complex; complexed with act |
PDB Entry: 4l5n (more details), 2.16 Å
SCOPe Domain Sequences for d4l5nb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l5nb_ c.18.1.1 (B:) automated matches {Herpes simplex virus type 1 [TaxId: 10299]}
dwttfrrvfliddawrplmepelanpltahllaeynrrcqteevlppredvfswtryctp
devrvviigqdpyhhpgqahglafsvranvppppslrnvlaavkncypearmsghgclek
wardgvlllnttltvkrgaaashsrigwdrfvggvirrlaarrpglvfmlwgthaqnair
pdprvhcvlkfshpsplskvpfgtcqhflvanryletrsispidwsv
Timeline for d4l5nb_: