Lineage for d4l5na_ (4l5n A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1355711Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 1355712Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families) (S)
  5. 1355713Family c.18.1.1: Uracil-DNA glycosylase [52142] (2 proteins)
  6. 1355764Protein automated matches [190540] (4 species)
    not a true protein
  7. 1355767Species Herpes simplex virus type 1 [TaxId:10299] [226744] (1 PDB entry)
  8. 1355768Domain d4l5na_: 4l5n A: [224565]
    automated match to d1laue_
    protein/DNA complex; complexed with act

Details for d4l5na_

PDB Entry: 4l5n (more details), 2.16 Å

PDB Description: Crystallographic Structure of HHV-1 Uracil-DNA Glycosylase complexed with the Bacillus phage PZA inhibitor protein p56
PDB Compounds: (A:) uracil-DNA glycosylase

SCOPe Domain Sequences for d4l5na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l5na_ c.18.1.1 (A:) automated matches {Herpes simplex virus type 1 [TaxId: 10299]}
pldwttfrrvfliddawrplmepelanpltahllaeynrrcqteevlppredvfswtryc
tpdevrvviigqdpyhhpgqahglafsvranvppppslrnvlaavkncypearmsghgcl
ekwardgvlllnttltvkrgaaashsrigwdrfvggvirrlaarrpglvfmlwgthaqna
irpdprvhcvlkfshpsplskvpfgtcqhflvanryletrsispidwsv

SCOPe Domain Coordinates for d4l5na_:

Click to download the PDB-style file with coordinates for d4l5na_.
(The format of our PDB-style files is described here.)

Timeline for d4l5na_: