SCOPe 2.08: Domain d4l5ha_: 4l5h A:

Lineage for d4l5ha_ (4l5h A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)
   sandwich; 11 strands in 2 sheets

4. Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (2 families)
   has two smaller insertion domains

5. Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (5 proteins)
   automatically mapped to Pfam PF00314

6. Protein automated matches [190195] (6 species)
   not a true protein

7. Species Grape (Vitis vinifera) [TaxId:29760] [194403] (4 PDB entries)

8. Domain d4l5ha_: 4l5h A: [224563]
   automated match to d4h8tb_
   complexed with gol

Details for d4l5ha_

PDB Entry: 4l5h, 1.8 Å

PDB Description: Structure of haze forming proteins in white wines: Vitis vinifera thaumatin-like proteins

PDB Compounds: (A:) vvtl1

SCOPe Domain Sequences for d4l5ha_:

Sequence; same for both SEQRES and ATOM records:

>d4l5ha_ b.25.1.1 (A:) automated matches {Grape (Vitis vinifera) [TaxId: 29760]}
atfdilnkctytvwaaaspgggrrldsgqswtitvnpgttnariwgrtsctfdangrgkc
etgdcngllecqgygsppntlaefalnqpnnldyidislvdgfnipmdfsgcrgiqcsvd
ingqcpselkapggcnnpctvfktneycctdgpgscgpttyskffkdrcpdaysypqddk
tslftcpsgtnykvtfcp

Timeline for d4l5ha_:

• d4l5ha_ first appeared in SCOPe 2.03
  
• d4l5ha_ appears in SCOPe 2.07