Lineage for d1nfic2 (1nfi C:20-189)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
Superfamily b.2.5: p53-like transcription factors [49417] (8 families) 
Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (7 proteins)
automatically mapped to Pfam PF00554
Protein p65 subunit of NF-kappa B (NFKB), N-terminal domain [49428] (3 species) 
Species Human (Homo sapiens) [TaxId:9606] [49430] (1 PDB entry) 
Domain d1nfic2: 1nfi C:20-189 [22456]
Other proteins in same PDB: d1nfia1, d1nfib_, d1nfic1, d1nfid_, d1nfie_, d1nfif_
Details for d1nfic2
PDB Entry: 1nfi (more details), 2.7 Å
PDB Description: i-kappa-b-alpha/nf-kappa-b complex
PDB Compounds: (C:) nf-kappa-b p65SCOPe Domain Sequences for d1nfic2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nfic2 b.2.5.3 (C:20-189) p65 subunit of NF-kappa B (NFKB), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
yveiieqpkqrgmrfrykcegrsagsipgerstdttkthptikingytgpgtvrislvtk
dpphrphphelvgkdcrdgfyeaelcpdrcihsfqnlgiqcvkkrdleqaisqriqtnnn
pfqvpieeqrgdydlnavrlcfqvtvrdpsgrplrlppvlphpifdnrap
SCOPe Domain Coordinates for d1nfic2:
Click to download the PDB-style file with coordinates for d1nfic2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1nfic2:
View in 3D
