![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.5: p53-like transcription factors [49417] (8 families) ![]() |
![]() | Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (7 proteins) automatically mapped to Pfam PF00554 |
![]() | Protein p65 subunit of NF-kappa B (NFKB), N-terminal domain [49428] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49430] (1 PDB entry) |
![]() | Domain d1nfic2: 1nfi C:20-189 [22456] Other proteins in same PDB: d1nfia1, d1nfib_, d1nfic1, d1nfid_, d1nfie_, d1nfif_ |
PDB Entry: 1nfi (more details), 2.7 Å
SCOPe Domain Sequences for d1nfic2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nfic2 b.2.5.3 (C:20-189) p65 subunit of NF-kappa B (NFKB), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} yveiieqpkqrgmrfrykcegrsagsipgerstdttkthptikingytgpgtvrislvtk dpphrphphelvgkdcrdgfyeaelcpdrcihsfqnlgiqcvkkrdleqaisqriqtnnn pfqvpieeqrgdydlnavrlcfqvtvrdpsgrplrlppvlphpifdnrap
Timeline for d1nfic2: