Lineage for d4l3qa1 (4l3q A:16-218)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137193Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2137194Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2138437Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2138438Protein automated matches [226839] (52 species)
    not a true protein
  7. 2138577Species Human (Homo sapiens) [TaxId:9606] [224896] (58 PDB entries)
  8. 2138731Domain d4l3qa1: 4l3q A:16-218 [224552]
    Other proteins in same PDB: d4l3qa3
    automated match to d1bdga1
    complexed with 926, glc

Details for d4l3qa1

PDB Entry: 4l3q (more details), 2.7 Å

PDB Description: crystal structure of glucokinase-activator complex
PDB Compounds: (A:) Glucokinase

SCOPe Domain Sequences for d4l3qa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l3qa1 c.55.1.0 (A:16-218) automated matches {Human (Homo sapiens) [TaxId: 9606]}
veqilaefqlqeedlkkvmrrmqkemdrglrletheeasvkmlptyvrstpegsevgdfl
sldlggtnfrvmlvkvgegeegqwsvktkhqmysipedamtgtaemlfdyisecisdfld
khqmkhkklplgftfsfpvrhedidkgillnwtkgfkasgaegnnvvgllrdaikrrgdf
emdvvamvndtvatmiscyyedh

SCOPe Domain Coordinates for d4l3qa1:

Click to download the PDB-style file with coordinates for d4l3qa1.
(The format of our PDB-style files is described here.)

Timeline for d4l3qa1: