Class b: All beta proteins [48724] (176 folds) |
Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) two constituent families are related by circular permutation |
Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins) topologically similar to the C-terminal domain of PapD |
Protein C2 domain from protein kinase c (alpha) [49578] (1 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [49579] (5 PDB entries) |
Domain d4l1la_: 4l1l A: [224551] automated match to d1dsya_ complexed with cd, so4 |
PDB Entry: 4l1l (more details), 1.6 Å
SCOPe Domain Sequences for d4l1la_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l1la_ b.7.1.2 (A:) C2 domain from protein kinase c (alpha) {Norway rat (Rattus norvegicus) [TaxId: 10116]} tekrgriylkaevtdeklhvtvrdaknlipmdpnglsdpyvklklipdpkneskqktkti rstlnpqwnesftfklkpsdkdrrlsveiwdwdrttrndfmgslsfgvselmkmpasgwy kllnqeegeyynvpipeg
Timeline for d4l1la_: