Lineage for d4l1la_ (4l1l A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2772794Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2772795Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) (S)
    two constituent families are related by circular permutation
  5. 2772956Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins)
    topologically similar to the C-terminal domain of PapD
  6. 2772957Protein C2 domain from protein kinase c (alpha) [49578] (1 species)
  7. 2772958Species Norway rat (Rattus norvegicus) [TaxId:10116] [49579] (7 PDB entries)
  8. 2772961Domain d4l1la_: 4l1l A: [224551]
    automated match to d1dsya_
    complexed with cd, so4

Details for d4l1la_

PDB Entry: 4l1l (more details), 1.6 Å

PDB Description: Rat PKC C2 domain bound to CD
PDB Compounds: (A:) Protein kinase C alpha type

SCOPe Domain Sequences for d4l1la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l1la_ b.7.1.2 (A:) C2 domain from protein kinase c (alpha) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
tekrgriylkaevtdeklhvtvrdaknlipmdpnglsdpyvklklipdpkneskqktkti
rstlnpqwnesftfklkpsdkdrrlsveiwdwdrttrndfmgslsfgvselmkmpasgwy
kllnqeegeyynvpipeg

SCOPe Domain Coordinates for d4l1la_:

Click to download the PDB-style file with coordinates for d4l1la_.
(The format of our PDB-style files is described here.)

Timeline for d4l1la_: