SCOPe 2.08: Domain d1nfia2: 1nfi A:20-189

Lineage for d1nfia2 (1nfi A:20-189)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (8 families)

5. Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (7 proteins)
   automatically mapped to Pfam PF00554

6. Protein p65 subunit of NF-kappa B (NFKB), N-terminal domain [49428] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49430] (1 PDB entry)

8. Domain d1nfia2: 1nfi A:20-189 [22455]
   Other proteins in same PDB: d1nfia1, d1nfib_, d1nfic1, d1nfid_, d1nfie_, d1nfif_

Details for d1nfia2

PDB Entry: 1nfi, 2.7 Å

PDB Description: i-kappa-b-alpha/nf-kappa-b complex

PDB Compounds: (A:) nf-kappa-b p65

SCOPe Domain Sequences for d1nfia2:

Sequence; same for both SEQRES and ATOM records:

>d1nfia2 b.2.5.3 (A:20-189) p65 subunit of NF-kappa B (NFKB), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
yveiieqpkqrgmrfrykcegrsagsipgerstdttkthptikingytgpgtvrislvtk
dpphrphphelvgkdcrdgfyeaelcpdrcihsfqnlgiqcvkkrdleqaisqriqtnnn
pfqvpieeqrgdydlnavrlcfqvtvrdpsgrplrlppvlphpifdnrap

Timeline for d1nfia2:

• d1nfia2 first appeared (with stable ids) in SCOP 1.55
  
• d1nfia2 appears in SCOPe 2.07