SCOPe 2.08: Domain d4l0ma1: 4l0m A:2-237

Lineage for d4l0ma1 (4l0m A:2-237)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.0: automated matches [191488] (1 protein)
   not a true family

6. Protein automated matches [190781] (46 species)
   not a true protein

7. Species Borrelia burgdorferi [TaxId:224326] [226750] (1 PDB entry)

8. Domain d4l0ma1: 4l0m A:2-237 [224545]
   Other proteins in same PDB: d4l0ma2
   automated match to d1nc3a_
   complexed with ade

Details for d4l0ma1

PDB Entry: 4l0m, 1.7 Å

PDB Description: crystal structure of a putative 5'-methylthioadenosine/s- adenosylhomocysteine nucleosidase from borrelia burgdorferi b31 bound to adenine (target nysgrc-029268 )

PDB Compounds: (A:) putative 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

SCOPe Domain Sequences for d4l0ma1:

Sequence; same for both SEQRES and ATOM records:

>d4l0ma1 c.56.2.0 (A:2-237) automated matches {Borrelia burgdorferi [TaxId: 224326]}
iliisamqeeseeinkildnkeeivlndylenkkiykgkilgkdvislttgigkvnaatw
ssqiiskykithiinsgssggikensnlkildiivssetayydfdltkfghkigqvpnlp
qkfkadeellkkvanivdnkllnidihigliltgdqfvdneknletikknfkdalavdme
gaaiaqvahifkipfiiirsisdlpnnkdnhidfnkflktssinsskmtkelirli

Timeline for d4l0ma1:

• d4l0ma1 first appeared in SCOPe 2.03, called d4l0ma_
  
• d4l0ma1 appears in SCOPe 2.07