Lineage for d4l0ma1 (4l0m A:2-237)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2887827Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2888846Family c.56.2.0: automated matches [191488] (1 protein)
    not a true family
  6. 2888847Protein automated matches [190781] (46 species)
    not a true protein
  7. 2888965Species Borrelia burgdorferi [TaxId:224326] [226750] (1 PDB entry)
  8. 2888966Domain d4l0ma1: 4l0m A:2-237 [224545]
    Other proteins in same PDB: d4l0ma2
    automated match to d1nc3a_
    complexed with ade

Details for d4l0ma1

PDB Entry: 4l0m (more details), 1.7 Å

PDB Description: crystal structure of a putative 5'-methylthioadenosine/s- adenosylhomocysteine nucleosidase from borrelia burgdorferi b31 bound to adenine (target nysgrc-029268 )
PDB Compounds: (A:) putative 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

SCOPe Domain Sequences for d4l0ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l0ma1 c.56.2.0 (A:2-237) automated matches {Borrelia burgdorferi [TaxId: 224326]}
iliisamqeeseeinkildnkeeivlndylenkkiykgkilgkdvislttgigkvnaatw
ssqiiskykithiinsgssggikensnlkildiivssetayydfdltkfghkigqvpnlp
qkfkadeellkkvanivdnkllnidihigliltgdqfvdneknletikknfkdalavdme
gaaiaqvahifkipfiiirsisdlpnnkdnhidfnkflktssinsskmtkelirli

SCOPe Domain Coordinates for d4l0ma1:

Click to download the PDB-style file with coordinates for d4l0ma1.
(The format of our PDB-style files is described here.)

Timeline for d4l0ma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4l0ma2