Lineage for d4l06e1 (4l06 E:3-414)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2513202Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2513203Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2513204Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
    the active site is between the two identical subunits
  6. 2513298Protein NADP-dependent isocitrate dehydrogenase [82524] (2 species)
  7. 2513299Species Human (Homo sapiens) [TaxId:9606] [110715] (31 PDB entries)
    Uniprot O75874
  8. 2513355Domain d4l06e1: 4l06 E:3-414 [224543]
    Other proteins in same PDB: d4l06a2, d4l06e2
    automated match to d3inmb_
    complexed with akg, ca, nap; mutant

Details for d4l06e1

PDB Entry: 4l06 (more details), 2.28 Å

PDB Description: crystal structure analysis of human idh1 mutants in complex with nadp+ and ca2+/alpha-ketoglutarate
PDB Compounds: (E:) isocitrate dehydrogenase [nadp] cytoplasmic

SCOPe Domain Sequences for d4l06e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l06e1 c.77.1.1 (E:3-414) NADP-dependent isocitrate dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}
kkisggsvvemqgdemtriiwelikeklifpyveldlhsydlgienrdatndqvtkdaae
aikkhnvgvkcatitpdekrveefklkqmwkspngtirnilggtvfreaiickniprlvs
gwvkpiiigrhaygdqdratdfvvpgpgkveitytpsdgtqkvtylvhnfeegggvamgm
ynqdksiedfahssfqmalskgwplylstkntilkkydgrfkdifqeiydkqyksqfeaq
kiwyehrliddmvaqamkseggfiwacknydgdvqsdsvaqgygslgmmtsvlvcpdgkt
veaeaahgtvtrhyrmyqkgqetstnpiasifawtrglahrakldnnkelaffanaleev
sietieagfmtkdlaacikglpnvqrsdylntfefmdklgenlkiklaqakl

SCOPe Domain Coordinates for d4l06e1:

Click to download the PDB-style file with coordinates for d4l06e1.
(The format of our PDB-style files is described here.)

Timeline for d4l06e1: