SCOP 1.55: Domain d1vkxa2: 1vkx A:19-191

Lineage for d1vkxa2 (1vkx A:19-191)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (7 superfamilies)

4. Superfamily b.2.5: p53-like transcription factors [49417] (1 family)

5. Family b.2.5.1: p53-like transcription factors [49418] (10 proteins)

6. Protein p65 subunit of NF-kappa B (NFKB), N-terminal domain [49428] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [49429] (4 PDB entries)

8. Domain d1vkxa2: 1vkx A:19-191 [22454]
   Other proteins in same PDB: d1vkxa1, d1vkxb1, d1vkxb2

Details for d1vkxa2

PDB Entry: 1vkx, 2.9 Å

PDB Description: crystal structure of the nfkb p50/p65 heterodimer complexed to the immunoglobulin kb dna

SCOP Domain Sequences for d1vkxa2:

Sequence; same for both SEQRES and ATOM records:

>d1vkxa2 b.2.5.1 (A:19-191) p65 subunit of NF-kappa B (NFKB), N-terminal domain {Mouse (Mus musculus)}
ayveiieqpkqrgmrfrykcegrsagsipgerstdttkthptikingytgpgtvrislvt
kdpphrphphelvgkdcrdgyyeadlcpdrsihsfqnlgiqcvkkrdleqaisqriqtnn
npfhvpieeqrgdydlnavrlcfqvtvrdpagrpllltpvlshpifdnrapnt

Timeline for d1vkxa2:

• d1vkxa2 appears in SCOP 1.57
  
• d1vkxa2 appears in the current release, SCOPe 2.08