Lineage for d1vkxa2 (1vkx A:19-191)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767925Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 2768236Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (7 proteins)
    automatically mapped to Pfam PF00554
  6. 2768260Protein p65 subunit of NF-kappa B (NFKB), N-terminal domain [49428] (3 species)
  7. 2768267Species Mouse (Mus musculus) [TaxId:10090] [49429] (9 PDB entries)
  8. 2768275Domain d1vkxa2: 1vkx A:19-191 [22454]
    Other proteins in same PDB: d1vkxa1, d1vkxb1, d1vkxb2
    protein/DNA complex

Details for d1vkxa2

PDB Entry: 1vkx (more details), 2.9 Å

PDB Description: crystal structure of the nfkb p50/p65 heterodimer complexed to the immunoglobulin kb dna
PDB Compounds: (A:) protein (nf-kappa b p65 subunit)

SCOPe Domain Sequences for d1vkxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vkxa2 b.2.5.3 (A:19-191) p65 subunit of NF-kappa B (NFKB), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
ayveiieqpkqrgmrfrykcegrsagsipgerstdttkthptikingytgpgtvrislvt
kdpphrphphelvgkdcrdgyyeadlcpdrsihsfqnlgiqcvkkrdleqaisqriqtnn
npfhvpieeqrgdydlnavrlcfqvtvrdpagrpllltpvlshpifdnrapnt

SCOPe Domain Coordinates for d1vkxa2:

Click to download the PDB-style file with coordinates for d1vkxa2.
(The format of our PDB-style files is described here.)

Timeline for d1vkxa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vkxa1