SCOPe 2.08: Domain d4l03a1: 4l03 A:3-414

Lineage for d4l03a1 (4l03 A:3-414)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
   consists of two intertwined (sub)domains related by pseudo dyad; duplication
   3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest

4. Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families)
   the constituent families form similar dimers

5. Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
   the active site is between the two identical subunits

6. Protein NADP-dependent isocitrate dehydrogenase [82524] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [110715] (31 PDB entries)
   Uniprot O75874

8. Domain d4l03a1: 4l03 A:3-414 [224536]
   Other proteins in same PDB: d4l03a2, d4l03c2
   automated match to d3inmb_
   complexed with akg, ca, edo, nap; mutant

Details for d4l03a1

PDB Entry: 4l03, 2.1 Å

PDB Description: crystal structure analysis of human idh1 mutants in complex with nadp+ and ca2+/alpha-ketoglutarate

PDB Compounds: (A:) isocitrate dehydrogenase [nadp] cytoplasmic

SCOPe Domain Sequences for d4l03a1:

Sequence; same for both SEQRES and ATOM records:

>d4l03a1 c.77.1.1 (A:3-414) NADP-dependent isocitrate dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}
kkisggsvvemqgdemtriiwelikeklifpyveldlhsydlgienrdatndqvtkdaae
aikkhnvgvkcatitpdekrveefklkqmwkspndtirnilggtvfreaiickniprlvs
gwvkpiiigrhaygdqyratdfvvpgpgkveitytpsdgtqkvtylvhnfeegggvamgm
ynqdksiedfahssfqmalskgwplylstkntilkkydgrfkdifqeiydkqyksqfeaq
kiwyehrliddmvaqamkseggfiwacknydgdvqsdsvaqgygslgmmtsvlvcpdgkt
veaeaahgtvtrhyrmyqkgqetstnpiasifawtrglahrakldnnkelaffanaleev
sietieagfmtkdlaacikglpnvqrsdylntfefmdklgenlkiklaqakl

Timeline for d4l03a1:

• d4l03a1 first appeared in SCOPe 2.03, called d4l03a_
  
• d4l03a1 appears in SCOPe 2.07