Lineage for d1ramb2 (1ram B:19-191)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2376992Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2377721Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 2378032Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (7 proteins)
    automatically mapped to Pfam PF00554
  6. 2378056Protein p65 subunit of NF-kappa B (NFKB), N-terminal domain [49428] (3 species)
  7. 2378063Species Mouse (Mus musculus) [TaxId:10090] [49429] (8 PDB entries)
  8. 2378068Domain d1ramb2: 1ram B:19-191 [22453]
    Other proteins in same PDB: d1rama1, d1ramb1
    protein/DNA complex; complexed with dtt

Details for d1ramb2

PDB Entry: 1ram (more details), 2.7 Å

PDB Description: a novel dna recognition mode by nf-kb p65 homodimer
PDB Compounds: (B:) protein (transcription factor nf-kb p65)

SCOPe Domain Sequences for d1ramb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ramb2 b.2.5.3 (B:19-191) p65 subunit of NF-kappa B (NFKB), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
pyveiieqpkqrgmrfrykcegrsagsipgerstdttkthptikingytgpgtvrislvt
kdpphrphphelvgkdcrdgyyeadlcpdrsihsfqnlgiqcvkkrdleqaisqriqtnn
npfhvpieeqrgdydlnavrlcfqvtvrdpagrpllltpvlshpifdnrapnt

SCOPe Domain Coordinates for d1ramb2:

Click to download the PDB-style file with coordinates for d1ramb2.
(The format of our PDB-style files is described here.)

Timeline for d1ramb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ramb1