SCOPe 2.06: Domain d1rama2: 1ram A:19-191

Lineage for d1rama2 (1ram A:19-191)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (8 families)

5. Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (7 proteins)
   automatically mapped to Pfam PF00554

6. Protein p65 subunit of NF-kappa B (NFKB), N-terminal domain [49428] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [49429] (8 PDB entries)

8. Domain d1rama2: 1ram A:19-191 [22452]
   Other proteins in same PDB: d1rama1, d1ramb1
   protein/DNA complex; complexed with dtt

Details for d1rama2

PDB Entry: 1ram, 2.7 Å

PDB Description: a novel dna recognition mode by nf-kb p65 homodimer

PDB Compounds: (A:) protein (transcription factor nf-kb p65)

SCOPe Domain Sequences for d1rama2:

Sequence; same for both SEQRES and ATOM records:

>d1rama2 b.2.5.3 (A:19-191) p65 subunit of NF-kappa B (NFKB), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
pyveiieqpkqrgmrfrykcegrsagsipgerstdttkthptikingytgpgtvrislvt
kdpphrphphelvgkdcrdgyyeadlcpdrsihsfqnlgiqcvkkrdleqaisqriqtnn
npfhvpieeqrgdydlnavrlcfqvtvrdpagrpllltpvlshpifdnrapnt

Timeline for d1rama2:

• d1rama2 first appeared (with stable ids) in SCOP 1.55
  
• d1rama2 appears in SCOPe 2.05
  
• d1rama2 appears in SCOPe 2.07
  
• d1rama2 appears in the current release, SCOPe 2.08