Lineage for d1rama2 (1ram A:19-191)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 368237Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (8 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 368422Superfamily b.2.5: p53-like transcription factors [49417] (6 families) (S)
  5. 368443Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (6 proteins)
  6. 368465Protein p65 subunit of NF-kappa B (NFKB), N-terminal domain [49428] (3 species)
  7. 368472Species Mouse (Mus musculus) [TaxId:10090] [49429] (7 PDB entries)
  8. 368476Domain d1rama2: 1ram A:19-191 [22452]
    Other proteins in same PDB: d1rama1, d1ramb1

Details for d1rama2

PDB Entry: 1ram (more details), 2.7 Å

PDB Description: a novel dna recognition mode by nf-kb p65 homodimer

SCOP Domain Sequences for d1rama2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rama2 b.2.5.3 (A:19-191) p65 subunit of NF-kappa B (NFKB), N-terminal domain {Mouse (Mus musculus)}
pyveiieqpkqrgmrfrykcegrsagsipgerstdttkthptikingytgpgtvrislvt
kdpphrphphelvgkdcrdgyyeadlcpdrsihsfqnlgiqcvkkrdleqaisqriqtnn
npfhvpieeqrgdydlnavrlcfqvtvrdpagrpllltpvlshpifdnrapnt

SCOP Domain Coordinates for d1rama2:

Click to download the PDB-style file with coordinates for d1rama2.
(The format of our PDB-style files is described here.)

Timeline for d1rama2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rama1