Lineage for d2ramb2 (2ram B:19-191)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2040316Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2040931Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 2041189Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (7 proteins)
    automatically mapped to Pfam PF00554
  6. 2041213Protein p65 subunit of NF-kappa B (NFKB), N-terminal domain [49428] (3 species)
  7. 2041220Species Mouse (Mus musculus) [TaxId:10090] [49429] (8 PDB entries)
  8. 2041223Domain d2ramb2: 2ram B:19-191 [22451]
    Other proteins in same PDB: d2rama1, d2ramb1
    protein/DNA complex; complexed with dtv

Details for d2ramb2

PDB Entry: 2ram (more details), 2.4 Å

PDB Description: a novel dna recognition mode by nf-kb p65 homodimer
PDB Compounds: (B:) protein (transcription factor nf-kb p65)

SCOPe Domain Sequences for d2ramb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ramb2 b.2.5.3 (B:19-191) p65 subunit of NF-kappa B (NFKB), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
pyveiieqpkqrgmrfrykcegrsagsipgerstdttkthptikingytgpgtvrislvt
kdpphrphphelvgkdcrdgyyeadlcpdrsihsfqnlgiqcvkkrdleqaisqriqtnn
npfhvpieeqrgdydlnavrlcfqvtvrdpagrpllltpvlshpifdnrapnt

SCOPe Domain Coordinates for d2ramb2:

Click to download the PDB-style file with coordinates for d2ramb2.
(The format of our PDB-style files is described here.)

Timeline for d2ramb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ramb1