Lineage for d4kvyc_ (4kvy C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010547Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2010548Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2010800Family a.128.1.4: Aristolochene/pentalenene synthase [48586] (3 protein domains)
  6. 2010815Protein automated matches [190618] (1 species)
    not a true protein
  7. 2010816Species Aspergillus terreus [TaxId:33178] [187650] (16 PDB entries)
  8. 2010823Domain d4kvyc_: 4kvy C: [224507]
    automated match to d2oa6d_
    complexed with gol, jf1, mg, pop

Details for d4kvyc_

PDB Entry: 4kvy (more details), 1.95 Å

PDB Description: Crystal structure of Aspergillus terreus aristolochene synthase complexed with (1S,8S,9aR)-1,9a-dimethyl-8-(prop-1-en-2-yl)decahydroquinolizin-5-ium
PDB Compounds: (C:) Aristolochene synthase

SCOPe Domain Sequences for d4kvyc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kvyc_ a.128.1.4 (C:) automated matches {Aspergillus terreus [TaxId: 33178]}
lepppstfqplchplveevskevdgyflqhwnfpnekarkkfvaagfsrvtclyfpkald
drihfacrlltvlfliddlleymsfeegsayneklipisrgdvlpdrsipveyiiydlwe
smrahdremadeilepvflfmraqtdrtrarpmglggyleyrerdvgkellaalmrfsmg
lklspselqrvreidancskhlsvvndiysyekelytsktahseggilctsvqilaqead
vtaeaakrvlfvmcrewelrhqllvarlsaegletpglaayvegleyqmsgnelwsqttl
rysv

SCOPe Domain Coordinates for d4kvyc_:

Click to download the PDB-style file with coordinates for d4kvyc_.
(The format of our PDB-style files is described here.)

Timeline for d4kvyc_: