SCOPe 2.03: Domain d4kvwb_: 4kvw B:

Lineage for d4kvwb_ (4kvw B:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
   multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers

4. Superfamily a.128.1: Terpenoid synthases [48576] (6 families)
   duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J

5. Family a.128.1.4: Aristolochene/pentalenene synthase [48586] (3 proteins)

6. Protein automated matches [190618] (1 species)
   not a true protein

7. Species Aspergillus terreus [TaxId:33178] [187650] (11 PDB entries)

8. Domain d4kvwb_: 4kvw B: [224502]
   automated match to d2oa6d_
   complexed with gol, jf4, mg, pop

Details for d4kvwb_

PDB Entry: 4kvw, 2.1 Å

PDB Description: Crystal structure of Aspergillus terreus aristolochene synthase complexed with (3R,6R,9aR)-6,9a-dimethyl-3-(prop-1-en-2-yl)decahydroquinolizin-5-ium

PDB Compounds: (B:) Aristolochene synthase

SCOPe Domain Sequences for d4kvwb_:

Sequence; same for both SEQRES and ATOM records:

>d4kvwb_ a.128.1.4 (B:) automated matches {Aspergillus terreus [TaxId: 33178]}
lepppstfqplchplveevskevdgyflqhwnfpnekarkkfvaagfsrvtclyfpkald
drihfacrlltvlfliddlleymsfeegsayneklipisrgdvlpdrsipveyiiydlwe
smrahdremadeilepvflfmraqtdrtrarpmglggyleyrerdvgkellaalmrfsmg
lklspselqrvreidancskhlsvvndiysyekelytsktahseggilctsvqilaqead
vtaeaakrvlfvmcrewelrhqllvarlsaegletpglaayvegleyqmsgnelwsqttl
rysv

Timeline for d4kvwb_:

• d4kvwb_ is new in SCOPe 2.03-stable
  
• d4kvwb_ appears in SCOPe 2.04
  
• d4kvwb_ appears in the current release, SCOPe 2.08