Lineage for d4kvsa_ (4kvs A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703838Family a.25.1.6: PMT1231-like [158402] (2 proteins)
    PfamB PB016165
    automatically mapped to Pfam PF11266
  6. 2703839Protein Hypothetical protein PMT1231 [158403] (1 species)
  7. 2703840Species Prochlorococcus marinus [TaxId:1219] [158404] (8 PDB entries)
    Uniprot Q7V6D4 20-241
  8. 2703841Domain d4kvsa_: 4kvs A: [224500]
    automated match to d2oc5a1
    complexed with 6na, fe; mutant

Details for d4kvsa_

PDB Entry: 4kvs (more details), 1.67 Å

PDB Description: Crystal Structure of Prochlorococcus marinus aldehyde-deformylating oxygenase (mutant A134F)
PDB Compounds: (A:) Aldehyde decarbonylase

SCOPe Domain Sequences for d4kvsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kvsa_ a.25.1.6 (A:) Hypothetical protein PMT1231 {Prochlorococcus marinus [TaxId: 1219]}
alpdftsdrykdaysrinaiviegeqeahdnyiaigtllpdhveelkrlakmemrhkkgf
tacgknlgveadmdfareffaplrdnfqtalgqgktptclliqallieafaisfyhtyip
vsdpfarkitegvvkdeythlnygeawlkanlescreelleanrenlplirrmldqvagd
aavlqmdkedliedfliayqeslteigfntreitrmaaaal

SCOPe Domain Coordinates for d4kvsa_:

Click to download the PDB-style file with coordinates for d4kvsa_.
(The format of our PDB-style files is described here.)

Timeline for d4kvsa_: