Lineage for d4kvra_ (4kvr A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1727563Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1727564Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1729639Family a.25.1.6: PMT1231-like [158402] (2 proteins)
    PfamB PB016165
    automatically mapped to Pfam PF11266
  6. 1729640Protein Hypothetical protein PMT1231 [158403] (1 species)
  7. 1729641Species Prochlorococcus marinus [TaxId:1219] [158404] (8 PDB entries)
    Uniprot Q7V6D4 20-241
  8. 1729646Domain d4kvra_: 4kvr A: [224499]
    automated match to d2oc5a1
    complexed with 6na, fe; mutant

Details for d4kvra_

PDB Entry: 4kvr (more details), 1.88 Å

PDB Description: Crystal Structure of Prochlorococcus marinus aldehyde-deformylating oxygenase (mutant V41Y)
PDB Compounds: (A:) Aldehyde decarbonylase

SCOPe Domain Sequences for d4kvra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kvra_ a.25.1.6 (A:) Hypothetical protein PMT1231 {Prochlorococcus marinus [TaxId: 1219]}
alpdftsdrykdaysrinaiyiegeqeahdnyiaigtllpdhveelkrlakmemrhkkgf
tacgknlgveadmdfareffaplrdnfqtalgqgktptclliqallieafaisayhtyip
vsdpfarkitegvvkdeythlnygeawlkanlescreelleanrenlplirrmldqvagd
aavlqmdkedliedfliayqeslteigfntreitrmaaaal

SCOPe Domain Coordinates for d4kvra_:

Click to download the PDB-style file with coordinates for d4kvra_.
(The format of our PDB-style files is described here.)

Timeline for d4kvra_: