Lineage for d1a3qb2 (1a3q B:37-226)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2040316Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2040931Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 2041189Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (7 proteins)
    automatically mapped to Pfam PF00554
  6. 2041209Protein p52 subunit of NF-kappa B (NFKB), N-terminal domain [49426] (1 species)
  7. 2041210Species Human (Homo sapiens) [TaxId:9606] [49427] (1 PDB entry)
  8. 2041212Domain d1a3qb2: 1a3q B:37-226 [22448]
    Other proteins in same PDB: d1a3qa1, d1a3qb1
    protein/DNA complex

Details for d1a3qb2

PDB Entry: 1a3q (more details), 2.1 Å

PDB Description: human nf-kappa-b p52 bound to dna
PDB Compounds: (B:) protein (nuclear factor kappa-b p52)

SCOPe Domain Sequences for d1a3qb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a3qb2 b.2.5.3 (B:37-226) p52 subunit of NF-kappa B (NFKB), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
gpylviveqpkqrgfrfrygcegpshgglpgassekgrktyptvkicnyegpakievdlv
thsdpprahahslvgkqcselgicavsvgpkdmtaqfnnlgvlhvtkknmmgtmiqklqr
qrlrsrpqglteaeqreleqeakelkkvmdlsivrlrfsaflrslplkpvisqpihdsks
pgas

SCOPe Domain Coordinates for d1a3qb2:

Click to download the PDB-style file with coordinates for d1a3qb2.
(The format of our PDB-style files is described here.)

Timeline for d1a3qb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a3qb1