SCOPe 2.05: Domain d4kuxa_: 4kux A:

Lineage for d4kuxa_ (4kux A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
   multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers

4. Superfamily a.128.1: Terpenoid synthases [48576] (6 families)
   duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J

5. Family a.128.1.4: Aristolochene/pentalenene synthase [48586] (3 proteins)

6. Protein automated matches [190618] (1 species)
   not a true protein

7. Species Aspergillus terreus [TaxId:33178] [187650] (11 PDB entries)

8. Domain d4kuxa_: 4kux A: [224477]
   automated match to d2oa6d_
   complexed with fps, gol, mg

Details for d4kuxa_

PDB Entry: 4kux, 1.9 Å

PDB Description: Crystal structure of Aspergillus terreus aristolochene synthase complexed with farnesyl thiolodiphosphate (FSPP)

PDB Compounds: (A:) Aristolochene synthase

SCOPe Domain Sequences for d4kuxa_:

Sequence; same for both SEQRES and ATOM records:

>d4kuxa_ a.128.1.4 (A:) automated matches {Aspergillus terreus [TaxId: 33178]}
lepppstfqplchplveevskevdgyflqhwnfpnekarkkfvaagfsrvtclyfpkald
drihfacrlltvlfliddlleymsfeegsayneklipisrgdvlpdrsipveyiiydlwe
smrahdremadeilepvflfmraqtdrtrarpmglggyleyrerdvgkellaalmrfsmg
lklspselqrvreidancskhlsvvndiysyekelytsktahseggilctsvqilaqead
vtaeaakrvlfvmcrewelrhqllvarlsaegletpglaayvegleyqmsgnelwsqttl
rysv

Timeline for d4kuxa_:

• d4kuxa_ first appeared in SCOPe 2.03
  
• d4kuxa_ appears in SCOPe 2.04
  
• d4kuxa_ appears in SCOPe 2.06
  
• d4kuxa_ appears in the current release, SCOPe 2.08