SCOPe 2.05: Domain d4kucd1: 4kuc D:21-126

Lineage for d4kucd1 (4kuc D:21-126)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries)

8. Domain d4kucd1: 4kuc D:21-126 [224474]
   Other proteins in same PDB: d4kuca_, d4kuci_
   automated match to d1rhha1
   protein/RNA complex

Details for d4kucd1

PDB Entry: 4kuc, 2.79 Å

PDB Description: Crystal structure of ricin-A chain in complex with the antibody 6C2

PDB Compounds: (D:) mAb6c2 fab-Heavy chain

SCOPe Domain Sequences for d4kucd1:

Sequence; same for both SEQRES and ATOM records:

>d4kucd1 b.1.1.0 (D:21-126) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divltqspaslavslgqratisyrasksvsymhwnqqkpgqpprlliylgsnlesgvgar
fsgsgsgtdftlnihpveeedaatyycqhkreypptfgqgtkveik

Timeline for d4kucd1:

• d4kucd1 first appeared in SCOPe 2.03
  
• d4kucd1 appears in SCOPe 2.04
  
• d4kucd1 appears in SCOPe 2.06
  
• d4kucd1 appears in the current release, SCOPe 2.08