Lineage for d4ktja_ (4ktj A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2004955Protein Cyp121 monooxygenase (P450 Mt2) [81865] (2 species)
  7. 2004956Species Mycobacterium tuberculosis [TaxId:1773] [81866] (35 PDB entries)
  8. 2004963Domain d4ktja_: 4ktj A: [224470]
    automated match to d4ipsa_
    complexed with hem, ktj, so4

Details for d4ktja_

PDB Entry: 4ktj (more details), 1.35 Å

PDB Description: crystal structure of mycobacterium tuberculosis cyp121 in complex with 4-(3-amino-1h-pyrazol-4-yl)phenol
PDB Compounds: (A:) Cytochrome P450 121

SCOPe Domain Sequences for d4ktja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ktja_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]}
atvllevpfsargdripdavaelrtrepirkvrtitgaeawlvssyalctqvledrrfsm
ketaaagaprlnaltvppevvnnmgniadaglrkavmkaitpkapgleqflrdtanslld
nlitegapadlrndfadplatalhckvlgipqedgpklfrslsiafmssadpipaakinw
drdieymagilenpnittglmgelsrlrkdpayshvsdelfatigvtffgagvistgsfl
ttalisliqrpqlrnllhekpelipagveellrinlsfadglprlatadiqvgdvlvrkg
elvlvlleganfdpehfpnpgsieldrpnptshlafgrgqhfcpgsalgrrhaqigieal
lkkmpgvdlavpidqlvwrtrfqrriperlpvlw

SCOPe Domain Coordinates for d4ktja_:

Click to download the PDB-style file with coordinates for d4ktja_.
(The format of our PDB-style files is described here.)

Timeline for d4ktja_: