Lineage for d1a3qa2 (1a3q A:37-226)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 105991Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (7 superfamilies)
  4. 106094Superfamily b.2.5: p53-like transcription factors [49417] (1 family) (S)
  5. 106095Family b.2.5.1: p53-like transcription factors [49418] (11 proteins)
  6. 106124Protein p52 subunit of NF-kappa B (NFKB), N-terminal domain [49426] (1 species)
  7. 106125Species Human (Homo sapiens) [TaxId:9606] [49427] (1 PDB entry)
  8. 106126Domain d1a3qa2: 1a3q A:37-226 [22447]
    Other proteins in same PDB: d1a3qa1, d1a3qb1

Details for d1a3qa2

PDB Entry: 1a3q (more details), 2.1 Å

PDB Description: human nf-kappa-b p52 bound to dna

SCOP Domain Sequences for d1a3qa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a3qa2 b.2.5.1 (A:37-226) p52 subunit of NF-kappa B (NFKB), N-terminal domain {Human (Homo sapiens)}
gpylviveqpkqrgfrfrygcegpshgglpgassekgrktyptvkicnyegpakievdlv
thsdpprahahslvgkqcselgicavsvgpkdmtaqfnnlgvlhvtkknmmgtmiqklqr
qrlrsrpqglteaeqreleqeakelkkvmdlsivrlrfsaflrslplkpvisqpihdsks
pgas

SCOP Domain Coordinates for d1a3qa2:

Click to download the PDB-style file with coordinates for d1a3qa2.
(The format of our PDB-style files is described here.)

Timeline for d1a3qa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a3qa1