![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (14 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [224855] (368 PDB entries) |
![]() | Domain d4krpc2: 4krp C:108-211 [224466] Other proteins in same PDB: d4krpb_, d4krpc1 automated match to d3fcta2 complexed with nag |
PDB Entry: 4krp (more details), 2.82 Å
SCOPe Domain Sequences for d4krpc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4krpc2 b.1.1.2 (C:108-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr
Timeline for d4krpc2: