SCOPe 2.08: Domain d4krpc2: 4krp C:108-211

Lineage for d4krpc2 (4krp C:108-211)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d4krpc2: 4krp C:108-211 [224466]
   Other proteins in same PDB: d4krpb_, d4krpc1, d4krpd_
   automated match to d3fcta2
   complexed with nag

Details for d4krpc2

PDB Entry: 4krp, 2.82 Å

PDB Description: nanobody/vhh domain 9g8 in complex with the extracellular region of egfr

PDB Compounds: (C:) Cetuximab light chain

SCOPe Domain Sequences for d4krpc2:

Sequence; same for both SEQRES and ATOM records:

>d4krpc2 b.1.1.2 (C:108-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

Timeline for d4krpc2:

• d4krpc2 first appeared in SCOPe 2.03
  
• d4krpc2 appears in SCOPe 2.07