SCOPe 2.08: Domain d4krna1: 4krn A:6-129

Lineage for d4krna1 (4krn A:6-129)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)

8. Domain d4krna1: 4krn A:6-129 [224463]
   Other proteins in same PDB: d4krna2
   automated match to d4aq1b_
   complexed with so4

Details for d4krna1

PDB Entry: 4krn, 1.55 Å

PDB Description: Nanobody/VHH domain EgA1

PDB Compounds: (A:) Nanobody/VHH domain EgA1

SCOPe Domain Sequences for d4krna1:

Sequence, based on SEQRES records:

>d4krna1 b.1.1.1 (A:6-129) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqpggslrlscaasgrtfssyamgwfrqapgkqrefvaairwsggytyytdsvk
grftisrdnakttvylqmnslkpedtavyycaatylssdysryalpqrpldydywgqgtq
vtvs

Sequence, based on observed residues (ATOM records):

>d4krna1 b.1.1.1 (A:6-129) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqpggslrlscaasgrtfssyamgwfrqapgkqrefvaairwsggytyytdsvk
grftisrdttvylqmnslkpedtavyycaatylssdysryalpqrpldydywgqgtqvtv
s

Timeline for d4krna1:

• d4krna1 first appeared in SCOPe 2.03, called d4krna_
  
• d4krna1 appears in SCOPe 2.07