Lineage for d1vkxb2 (1vkx B:339-546)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10320Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (7 superfamilies)
  4. 10414Superfamily b.2.5: p53-like transcription factors [49417] (1 family) (S)
  5. 10415Family b.2.5.1: p53-like transcription factors [49418] (10 proteins)
  6. 10423Protein p50 subunit of NF-kappa B (NFKB), N-terminal domain [49423] (2 species)
  7. 10426Species Mouse (Mus musculus) [TaxId:10090] [49425] (2 PDB entries)
  8. 10429Domain d1vkxb2: 1vkx B:339-546 [22446]
    Other proteins in same PDB: d1vkxa1, d1vkxa2, d1vkxb1

Details for d1vkxb2

PDB Entry: 1vkx (more details), 2.9 Å

PDB Description: crystal structure of the nfkb p50/p65 heterodimer complexed to the immunoglobulin kb dna

SCOP Domain Sequences for d1vkxb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vkxb2 b.2.5.1 (B:339-546) p50 subunit of NF-kappa B (NFKB), N-terminal domain {Mouse (Mus musculus)}
gpylqileqpkqrgfrfryvcegpshgglpgasseknkksypqvkicnyvgpakvivqlv
tngknihlhahslvgkhcedgvctvtagpkdmvvgfanlgilhvtkkkvfetlearmtea
cirgynpgllvhsdlaylqaegggdrqltdrekeiirqaavqqtkemdlsvvrlmftafl
pdstgsftrrlepvvsdaiydskapnas

SCOP Domain Coordinates for d1vkxb2:

Click to download the PDB-style file with coordinates for d1vkxb2.
(The format of our PDB-style files is described here.)

Timeline for d1vkxb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vkxb1