![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein automated matches [190119] (19 species) not a true protein |
![]() | Species Llama (Lama glama) [TaxId:9844] [187485] (76 PDB entries) |
![]() | Domain d4krmb_: 4krm B: [224457] Other proteins in same PDB: d4krma1, d4krma2, d4krmc1, d4krmc2, d4krme1, d4krme2, d4krmg1, d4krmi1, d4krmi2, d4krmk1, d4krmk2 automated match to d4jvpa_ complexed with nag |
PDB Entry: 4krm (more details), 2.65 Å
SCOPe Domain Sequences for d4krmb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4krmb_ b.1.1.1 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]} qvkleesgggsvqtggslrltcaasgrtsrsygmgwfrqapgkerefvsgiswrgdstgy adsvkgrftisrdnakntvdlqmnslkpedtaiyycaaaagsawygtlyeydywgqgtqv tvss
Timeline for d4krmb_: