Lineage for d4krlb_ (4krl B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2023921Protein automated matches [190119] (22 species)
    not a true protein
  7. 2024425Species Llama (Lama glama) [TaxId:9844] [187485] (138 PDB entries)
  8. 2024617Domain d4krlb_: 4krl B: [224456]
    Other proteins in same PDB: d4krla1, d4krla2, d4krla3
    automated match to d4jvpa_
    complexed with iod, mes, nag

Details for d4krlb_

PDB Entry: 4krl (more details), 2.85 Å

PDB Description: nanobody/vhh domain 7d12 in complex with domain iii of the extracellular region of egfr, ph 6.0
PDB Compounds: (B:) Nanobody/VHH domain 7D12

SCOPe Domain Sequences for d4krlb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4krlb_ b.1.1.1 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvkleesgggsvqtggslrltcaasgrtsrsygmgwfrqapgkerefvsgiswrgdstgy
adsvkgrftisrdnakntvdlqmnslkpedtaiyycaaaagsawygtlyeydywgqgtqv
tv

SCOPe Domain Coordinates for d4krlb_:

Click to download the PDB-style file with coordinates for d4krlb_.
(The format of our PDB-style files is described here.)

Timeline for d4krlb_: