![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
![]() | Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) ![]() N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
![]() | Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
![]() | Protein automated matches [226851] (46 species) not a true protein |
![]() | Species Slackia exigua [TaxId:649764] [226701] (2 PDB entries) |
![]() | Domain d4kqxb2: 4kqx B:194-342 [224453] Other proteins in same PDB: d4kqxa1, d4kqxb1, d4kqxb3 automated match to d1np3a1 complexed with hio, his, mg, nad; mutant |
PDB Entry: 4kqx (more details), 1.8 Å
SCOPe Domain Sequences for d4kqxb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kqxb2 a.100.1.0 (B:194-342) automated matches {Slackia exigua [TaxId: 649764]} faeeteedlfgeqavlcgglvelvkagfetlteagyppelayfecyhemkmivdlmyesg ihfmnysisntaeygeyyagpkvineqsreamkeilkriqdgsfaqefvddcnnghkrll eqreainthpiettgaqirsmfswikked
Timeline for d4kqxb2: