SCOPe 2.08: Domain d4kqxa2: 4kqx A:194-335

Lineage for d4kqxa2 (4kqx A:194-335)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.0: automated matches [227147] (1 protein)
   not a true family

6. Protein automated matches [226851] (46 species)
   not a true protein

7. Species Slackia exigua [TaxId:649764] [226701] (2 PDB entries)

8. Domain d4kqxa2: 4kqx A:194-335 [224451]
   Other proteins in same PDB: d4kqxa1, d4kqxb1, d4kqxb3
   automated match to d1np3a1
   complexed with hio, his, mg, nad; mutant

Details for d4kqxa2

PDB Entry: 4kqx, 1.8 Å

PDB Description: Mutant Slackia exigua KARI DDV in complex with NAD and an inhibitor

PDB Compounds: (A:) Ketol-acid reductoisomerase

SCOPe Domain Sequences for d4kqxa2:

Sequence; same for both SEQRES and ATOM records:

>d4kqxa2 a.100.1.0 (A:194-335) automated matches {Slackia exigua [TaxId: 649764]}
faeeteedlfgeqavlcgglvelvkagfetlteagyppelayfecyhemkmivdlmyesg
ihfmnysisntaeygeyyagpkvineqsreamkeilkriqdgsfaqefvddcnnghkrll
eqreainthpiettgaqirsmf

Timeline for d4kqxa2:

• d4kqxa2 first appeared in SCOPe 2.03
  
• d4kqxa2 appears in SCOPe 2.07