| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (319 species) not a true protein |
| Species Slackia exigua [TaxId:649764] [226700] (2 PDB entries) |
| Domain d4kqxa1: 4kqx A:14-193 [224450] Other proteins in same PDB: d4kqxa2, d4kqxb2, d4kqxb3 automated match to d1np3a2 complexed with hio, his, mg, nad; mutant |
PDB Entry: 4kqx (more details), 1.8 Å
SCOPe Domain Sequences for d4kqxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kqxa1 c.2.1.0 (A:14-193) automated matches {Slackia exigua [TaxId: 649764]}
ilyeqdvdpkviqglkvgiigygsqghahalnlmdsgvdvrvglregdsdwktaeeaglk
vtdmdtaaeeadvimvlvpdevqpkvyqehiaahlkagntlafahgfnihygyivppedv
nvimcapkgpghivrrqftegsgvpdlacvqqdatgnawdivlsycwgvggarsgiikat
Timeline for d4kqxa1: