SCOPe 2.08: Domain d4kqxa1: 4kqx A:14-193

Lineage for d4kqxa1 (4kqx A:14-193)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Slackia exigua [TaxId:649764] [226700] (2 PDB entries)

8. Domain d4kqxa1: 4kqx A:14-193 [224450]
   Other proteins in same PDB: d4kqxa2, d4kqxb2, d4kqxb3
   automated match to d1np3a2
   complexed with hio, his, mg, nad; mutant

Details for d4kqxa1

PDB Entry: 4kqx, 1.8 Å

PDB Description: Mutant Slackia exigua KARI DDV in complex with NAD and an inhibitor

PDB Compounds: (A:) Ketol-acid reductoisomerase

SCOPe Domain Sequences for d4kqxa1:

Sequence; same for both SEQRES and ATOM records:

>d4kqxa1 c.2.1.0 (A:14-193) automated matches {Slackia exigua [TaxId: 649764]}
ilyeqdvdpkviqglkvgiigygsqghahalnlmdsgvdvrvglregdsdwktaeeaglk
vtdmdtaaeeadvimvlvpdevqpkvyqehiaahlkagntlafahgfnihygyivppedv
nvimcapkgpghivrrqftegsgvpdlacvqqdatgnawdivlsycwgvggarsgiikat

Timeline for d4kqxa1:

• d4kqxa1 first appeared in SCOPe 2.03
  
• d4kqxa1 appears in SCOPe 2.07