SCOP 1.57: Domain d1nfkb2: 1nfk B:39-250

Lineage for d1nfkb2 (1nfk B:39-250)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (7 superfamilies)

4. Superfamily b.2.5: p53-like transcription factors [49417] (1 family)

5. Family b.2.5.1: p53-like transcription factors [49418] (10 proteins)

6. Protein p50 subunit of NF-kappa B (NFKB), N-terminal domain [49423] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [49425] (2 PDB entries)

8. Domain d1nfkb2: 1nfk B:39-250 [22445]
   Other proteins in same PDB: d1nfka1, d1nfkb1

Details for d1nfkb2

PDB Entry: 1nfk, 2.3 Å

PDB Description: structure of the nuclear factor kappa-b (nf-kb) p50 homodimer

SCOP Domain Sequences for d1nfkb2:

Sequence; same for both SEQRES and ATOM records:

>d1nfkb2 b.2.5.1 (B:39-250) p50 subunit of NF-kappa B (NFKB), N-terminal domain {Mouse (Mus musculus)}
gpylqileqpkqrgfrfryvcegpshgglpgasseknkksypqvkicnyvgpakvivqlv
tngknihlhahslvgkhcedgvctvtagpkdmvvgfanlgilhvtkkkvfetlearmtea
cirgynpgllvhsdlaylqaegggdrqltdrekeiirqaavqqtkemdlsvvrlmftafl
pdstgsftrrlepvvsdaiydskapnasnlki

Timeline for d1nfkb2:

• d1nfkb2 first appeared (with stable ids) in SCOP 1.55
  
• d1nfkb2 appears in SCOP 1.59
  
• d1nfkb2 appears in the current release, SCOPe 2.08