| Class b: All beta proteins [48724] (180 folds) |
| Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.5: p53-like transcription factors [49417] (8 families) ![]() |
| Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (7 proteins) automatically mapped to Pfam PF00554 |
| Protein p50 subunit of NF-kappa B (NFKB), N-terminal domain [49423] (2 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [49425] (7 PDB entries) |
| Domain d1nfkb2: 1nfk B:39-250 [22445] Other proteins in same PDB: d1nfka1, d1nfkb1 protein/DNA complex |
PDB Entry: 1nfk (more details), 2.3 Å
SCOPe Domain Sequences for d1nfkb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nfkb2 b.2.5.3 (B:39-250) p50 subunit of NF-kappa B (NFKB), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
gpylqileqpkqrgfrfryvcegpshgglpgasseknkksypqvkicnyvgpakvivqlv
tngknihlhahslvgkhcedgvctvtagpkdmvvgfanlgilhvtkkkvfetlearmtea
cirgynpgllvhsdlaylqaegggdrqltdrekeiirqaavqqtkemdlsvvrlmftafl
pdstgsftrrlepvvsdaiydskapnasnlki
Timeline for d1nfkb2: