Lineage for d4kqwb2 (4kqw B:194-337)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1276308Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 1276309Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 1276508Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 1276509Protein automated matches [226851] (23 species)
    not a true protein
  7. 1276619Species Slackia exigua [TaxId:649764] [226701] (2 PDB entries)
  8. 1276621Domain d4kqwb2: 4kqw B:194-337 [224449]
    Other proteins in same PDB: d4kqwa1, d4kqwb1
    automated match to d1np3a1
    complexed with mg, nap, tla

Details for d4kqwb2

PDB Entry: 4kqw (more details), 1.39 Å

PDB Description: The structure of the Slackia exigua KARI in complex with NADP
PDB Compounds: (B:) Ketol-acid reductoisomerase

SCOPe Domain Sequences for d4kqwb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kqwb2 a.100.1.0 (B:194-337) automated matches {Slackia exigua [TaxId: 649764]}
faeeteedlfgeqavlcgglvelvkagfetlteagyppelayfecyhemkmivdlmyesg
ihfmnysisntaeygeyyagpkvineqsreamkeilkriqdgsfaqefvddcnnghkrll
eqreainthpiettgaqirsmfsw

SCOPe Domain Coordinates for d4kqwb2:

Click to download the PDB-style file with coordinates for d4kqwb2.
(The format of our PDB-style files is described here.)

Timeline for d4kqwb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4kqwb1