| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) ![]() N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
| Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
| Protein automated matches [226851] (23 species) not a true protein |
| Species Slackia exigua [TaxId:649764] [226701] (2 PDB entries) |
| Domain d4kqwb2: 4kqw B:194-337 [224449] Other proteins in same PDB: d4kqwa1, d4kqwb1 automated match to d1np3a1 complexed with mg, nap, tla |
PDB Entry: 4kqw (more details), 1.39 Å
SCOPe Domain Sequences for d4kqwb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kqwb2 a.100.1.0 (B:194-337) automated matches {Slackia exigua [TaxId: 649764]}
faeeteedlfgeqavlcgglvelvkagfetlteagyppelayfecyhemkmivdlmyesg
ihfmnysisntaeygeyyagpkvineqsreamkeilkriqdgsfaqefvddcnnghkrll
eqreainthpiettgaqirsmfsw
Timeline for d4kqwb2: