SCOPe 2.07: Domain d4kqwb2: 4kqw B:194-337

Lineage for d4kqwb2 (4kqw B:194-337)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.0: automated matches [227147] (1 protein)
   not a true family

6. Protein automated matches [226851] (35 species)
   not a true protein

7. Species Slackia exigua [TaxId:649764] [226701] (2 PDB entries)

8. Domain d4kqwb2: 4kqw B:194-337 [224449]
   Other proteins in same PDB: d4kqwa1, d4kqwb1
   automated match to d1np3a1
   complexed with mg, nap, tla

Details for d4kqwb2

PDB Entry: 4kqw, 1.39 Å

PDB Description: The structure of the Slackia exigua KARI in complex with NADP

PDB Compounds: (B:) Ketol-acid reductoisomerase

SCOPe Domain Sequences for d4kqwb2:

Sequence; same for both SEQRES and ATOM records:

>d4kqwb2 a.100.1.0 (B:194-337) automated matches {Slackia exigua [TaxId: 649764]}
faeeteedlfgeqavlcgglvelvkagfetlteagyppelayfecyhemkmivdlmyesg
ihfmnysisntaeygeyyagpkvineqsreamkeilkriqdgsfaqefvddcnnghkrll
eqreainthpiettgaqirsmfsw

Timeline for d4kqwb2:

• d4kqwb2 first appeared in SCOPe 2.03
  
• d4kqwb2 appears in SCOPe 2.06