SCOPe 2.05: Domain d4kqwb1: 4kqw B:13-193

Lineage for d4kqwb1 (4kqw B:13-193)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (203 species)
   not a true protein

7. Species Slackia exigua [TaxId:649764] [226700] (2 PDB entries)

8. Domain d4kqwb1: 4kqw B:13-193 [224448]
   Other proteins in same PDB: d4kqwa2, d4kqwb2
   automated match to d1np3a2
   complexed with mg, nap, tla

Details for d4kqwb1

PDB Entry: 4kqw, 1.39 Å

PDB Description: The structure of the Slackia exigua KARI in complex with NADP

PDB Compounds: (B:) Ketol-acid reductoisomerase

SCOPe Domain Sequences for d4kqwb1:

Sequence; same for both SEQRES and ATOM records:

>d4kqwb1 c.2.1.0 (B:13-193) automated matches {Slackia exigua [TaxId: 649764]}
tilyeqdvdpkviqglkvgiigygsqghahalnlmdsgvdvrvglregssswktaeeagl
kvtdmdtaaeeadvimvlvpdeiqpkvyqehiaahlkagntlafahgfnihygyivpped
vnvimcapkgpghivrrqftegsgvpdlacvqqdatgnawdivlsycwgvggarsgiika
t

Timeline for d4kqwb1:

• d4kqwb1 first appeared in SCOPe 2.03
  
• d4kqwb1 appears in SCOPe 2.04
  
• d4kqwb1 appears in SCOPe 2.06
  
• d4kqwb1 appears in the current release, SCOPe 2.08