Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (181 species) not a true protein |
Species Slackia exigua [TaxId:649764] [226700] (2 PDB entries) |
Domain d4kqwb1: 4kqw B:13-193 [224448] Other proteins in same PDB: d4kqwa2, d4kqwb2 automated match to d1np3a2 complexed with mg, nap, tla |
PDB Entry: 4kqw (more details), 1.39 Å
SCOPe Domain Sequences for d4kqwb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kqwb1 c.2.1.0 (B:13-193) automated matches {Slackia exigua [TaxId: 649764]} tilyeqdvdpkviqglkvgiigygsqghahalnlmdsgvdvrvglregssswktaeeagl kvtdmdtaaeeadvimvlvpdeiqpkvyqehiaahlkagntlafahgfnihygyivpped vnvimcapkgpghivrrqftegsgvpdlacvqqdatgnawdivlsycwgvggarsgiika t
Timeline for d4kqwb1: