Lineage for d4kpsa1 (4kps A:6-327)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2040266Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2040267Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2040314Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 protein domains)
  6. 2040315Protein Hemagglutinin [49824] (9 species)
    includes rudiment esterase domain
  7. 2040355Species Influenza A virus, different strains [TaxId:11320] [49825] (116 PDB entries)
  8. 2040446Domain d4kpsa1: 4kps A:6-327 [224443]
    Other proteins in same PDB: d4kpsa2, d4kpsb_, d4kpsc2, d4kpsd_, d4kpse2, d4kpsf_
    automated match to d1rd8a_
    complexed with nag

Details for d4kpsa1

PDB Entry: 4kps (more details), 2.59 Å

PDB Description: Structure and receptor binding specificity of the hemagglutinin H13 from avian influenza A virus H13N6
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d4kpsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kpsa1 b.19.1.2 (A:6-327) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
dricvgylstnsservdtllengvpvtssidlietnhtgtycslngvspvhlgdcsfegw
ivgnpactsnfgirewsyliedpaaphglcypgelnnngelrhlfsgirsfsrtelippt
swgevldgttsacrdntgtnsfyrnlvwfikknnrypvisktynnttgrdvlvlwgihhp
vsvdetktlyvnsdpytlvstkswsekykletgvrpgyngqrswmkiywslihpgemitf
esnggflaprygyiieeygkgrifqsrirmsrcntkcqtsvggintnrtfqnidknalgd
cpkyiksgqlklatglrnvpai

SCOPe Domain Coordinates for d4kpsa1:

Click to download the PDB-style file with coordinates for d4kpsa1.
(The format of our PDB-style files is described here.)

Timeline for d4kpsa1: