Lineage for d4kpqa_ (4kpq A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1531182Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1531183Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1531228Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1531229Protein Hemagglutinin [49824] (6 species)
    includes rudiment esterase domain
  7. 1531245Species Influenza A virus, different strains [TaxId:11320] [49825] (99 PDB entries)
  8. 1531333Domain d4kpqa_: 4kpq A: [224440]
    Other proteins in same PDB: d4kpqb_, d4kpqd_, d4kpqf_
    automated match to d1rd8a_
    complexed with nag

Details for d4kpqa_

PDB Entry: 4kpq (more details), 2.5 Å

PDB Description: Structure and receptor binding specificity of the hemagglutinin H13 from avian influenza A virus H13N6
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d4kpqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kpqa_ b.19.1.2 (A:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
iqdricvgylstnsservdtllengvpvtssidlietnhtgtycslngvspvhlgdcsfe
gwivgnpactsnfgirewsyliedpaaphglcypgelnnngelrhlfsgirsfsrtelip
ptswgevldgttsacrdntgtnsfyrnlvwfikknnrypvisktynnttgrdvlvlwgih
hpvsvdetktlyvnsdpytlvstkswsekykletgvrpgyngqrswmkiywslihpgemi
tfesnggflaprygyiieeygkgrifqsrirmsrcntkcqtsvggintnrtfqnidknal
gdcpkyiksgqlklatglrnvpai

SCOPe Domain Coordinates for d4kpqa_:

Click to download the PDB-style file with coordinates for d4kpqa_.
(The format of our PDB-style files is described here.)

Timeline for d4kpqa_: