Lineage for d4kpqa1 (4kpq A:6-327)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2775521Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2775522Protein Hemagglutinin [49824] (22 species)
    includes rudiment esterase domain
  7. 2775631Species Influenza A virus, different strains [TaxId:11320] [49825] (131 PDB entries)
  8. 2775727Domain d4kpqa1: 4kpq A:6-327 [224440]
    Other proteins in same PDB: d4kpqa2, d4kpqb_, d4kpqc2, d4kpqd_, d4kpqe2, d4kpqf_
    automated match to d1rd8a_
    complexed with nag

Details for d4kpqa1

PDB Entry: 4kpq (more details), 2.5 Å

PDB Description: structure and receptor binding specificity of the hemagglutinin h13 from avian influenza a virus h13n6
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d4kpqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kpqa1 b.19.1.2 (A:6-327) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
dricvgylstnsservdtllengvpvtssidlietnhtgtycslngvspvhlgdcsfegw
ivgnpactsnfgirewsyliedpaaphglcypgelnnngelrhlfsgirsfsrtelippt
swgevldgttsacrdntgtnsfyrnlvwfikknnrypvisktynnttgrdvlvlwgihhp
vsvdetktlyvnsdpytlvstkswsekykletgvrpgyngqrswmkiywslihpgemitf
esnggflaprygyiieeygkgrifqsrirmsrcntkcqtsvggintnrtfqnidknalgd
cpkyiksgqlklatglrnvpai

SCOPe Domain Coordinates for d4kpqa1:

Click to download the PDB-style file with coordinates for d4kpqa1.
(The format of our PDB-style files is described here.)

Timeline for d4kpqa1: