| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (12 families) ![]() |
| Family d.2.1.8: RPF-like [159824] (2 proteins) Pfam PF06737; Transglycosylase-like domain |
| Protein automated matches [193952] (1 species) not a true protein |
| Species Mycobacterium tuberculosis [TaxId:1773] [193953] (3 PDB entries) |
| Domain d4kpmc_: 4kpm C: [224438] automated match to d4emnd_ complexed with ben, so4 |
PDB Entry: 4kpm (more details), 1.33 Å
SCOPe Domain Sequences for d4kpmc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kpmc_ d.2.1.8 (C:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
siwdaiagceaggnwaintgngyyggvqfdqgtweangglryapradlatreeqiavaev
trlrqgwgawpvcaaragar
Timeline for d4kpmc_: