![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (16 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [224855] (498 PDB entries) |
![]() | Domain d4kphm2: 4kph M:108-210 [224435] Other proteins in same PDB: d4kphl1, d4kphm1 automated match to d2fd6l2 complexed with act |
PDB Entry: 4kph (more details), 2.59 Å
SCOPe Domain Sequences for d4kphm2:
Sequence, based on SEQRES records: (download)
>d4kphm2 b.1.1.2 (M:108-210) automated matches {Mouse (Mus musculus) [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfn
>d4kphm2 b.1.1.2 (M:108-210) automated matches {Mouse (Mus musculus) [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwvlnswtdqdskdstysmss tltltkyerhnsytceathktstspivksfn
Timeline for d4kphm2: